PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.E01809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 198aa    MW: 22782.9 Da    PI: 6.3716
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.E01809.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF74.77.3e-24958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien ++rq tf kRr g++KKA ELSvLCd++ ++++fs++gkly y 
  Pahal.E01809.1  9 KRIENPTQRQSTFYKRRDGLFKKARELSVLCDVDLLLLLFSTSGKLYHYL 58
                    79*********************************************996 PP

2K-box29.53e-1172169198
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     y++++++++++   ++ + el+k ++  e +++e+R +  +d e+ ++  L+ Le++Le ++ k+Rs K++ +  +i +l +  +  qee   L 
  Pahal.E01809.1  72 YEAATHTKVWTDIRQERRAELEKAEQMCELMEKELRFMTVDDGEQYTVPSLELLEHNLEAAMHKVRSEKDRKIGGEITYLENIIRGRQEERYGLC 166
                     566778889***********************************************************************999999998888887 PP

           K-box  96 kkl 98 
                      kl
  Pahal.E01809.1 167 DKL 169
                     766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-32160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.581161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-28291IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-23323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.9E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-232338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-233859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-1284169IPR002487Transcription factor, K-box
PROSITE profilePS512979.98285175IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MGRGRSEIKR IENPTQRQST FYKRRDGLFK KARELSVLCD VDLLLLLFST SGKLYHYLSP  60
TVPSVKDLVE RYEAATHTKV WTDIRQERRA ELEKAEQMCE LMEKELRFMT VDDGEQYTVP  120
SLELLEHNLE AAMHKVRSEK DRKIGGEITY LENIIRGRQE ERYGLCDKLA HSQALNNDEE  180
AGSTSLSNGL ELKLGFN*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9750460.0EU975046.1 Zea mays clone 465896 MADS-box transcription factor 32 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004969809.11e-129PREDICTED: MADS-box transcription factor 32 isoform X1
SwissprotQ8S1511e-121MAD32_ORYSJ; MADS-box transcription factor 32
TrEMBLK3XM651e-129K3XM65_SETIT; Uncharacterized protein
STRINGSi002988m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119233439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.27e-23MIKC_MADS family protein